Catalogue/Tissue & Regenerative Research/TB-500
Tissue & Regenerative Research

TB-500

Thymosin Beta-4 fragment (TB-500)

Sold outStock quantity: 0
Request availability update
Reference presentationSynthetic peptide
Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Length
43 aa
Section 01

Product identity

Product name
TB-500
Expanded name
Thymosin Beta-4 fragment (TB-500)
Synonyms
Thymosin β4 fragment, Tβ4 (1-43)
Research category
Tissue & Regenerative Research
Compound type
Synthetic peptide
Section 02

Research intelligence

Research area

Tissue Research

Molecule type

Synthetic peptide

Peptide length

43 amino acids

Documentation status

Not yet verified

Batch verification status

Not yet verified

Stock status

Sold out · quantity 0

Section 03

Reference chemical information

Reference chemical information is provided for compound identification only. The exact form, salt, counter-ion, hydration state and molecular mass of a supplied material must be confirmed against its batch-specific Certificate of Analysis and Safety Data Sheet.

Reference sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Sequence length
43 amino acids
Reference molecular formula
C212H350N56O78S
Reference molecular weight
4963.44 g/mol
Reference CAS number
77591-33-4
Reference database
PubChem CID 16132341 (Thymosin β4)
Technical note

The name TB-500 is commonly used in the research-peptide supply market for material related to Thymosin Beta-4 or a defined fragment thereof. The exact supplied sequence, salt form and molecular mass must be confirmed against the manufacturer's batch documentation.

Section 04

Research context

TB-500 is a synthetic peptide related to the naturally occurring protein Thymosin Beta-4. It is investigated in experimental cell-motility, actin-binding and tissue-research contexts.

Section 05

Current product specification

Values below reflect the physical material available for release. Fields are populated only from manufacturer documentation, a batch-specific Certificate of Analysis, an independent laboratory report or a Safety Data Sheet. Until such documents are received and verified, fields remain marked Pending batch-specific documentation.

Stock status
Sold out
Stock quantity
0
Catalogue SKU
Pending batch-specific documentation
Actual supplied chemical form
Pending batch-specific documentation
Counter-ion or salt form
Pending batch-specific documentation
Nominal vial content
Pending batch-specific documentation
Supplier
Pending batch-specific documentation
Manufacturer
Pending batch-specific documentation
Country of manufacture
Pending batch-specific documentation
Batch number
Pending batch-specific documentation
Lot number
Pending batch-specific documentation
Purity result
Pending batch-specific documentation
Identity result
Pending batch-specific documentation
HPLC result
Pending batch-specific documentation
LC-MS result
Pending batch-specific documentation
Water content
Pending batch-specific documentation
Residual solvent result
Pending batch-specific documentation
Endotoxin result
Pending batch-specific documentation
Bioburden result
Pending batch-specific documentation
Sterility result
Pending batch-specific documentation
Manufacturing date
Pending batch-specific documentation
Retest or expiry date
Pending batch-specific documentation
Storage requirement
Pending batch-specific documentation
COA file
Not supplied
SDS file
Not supplied
Independent test report
Not supplied
Document verification status
Not yet verified
Section 06

Batch documentation

Certificate of Analysis
Not supplied
Safety Data Sheet
Not supplied
Independent test report
Not supplied
Document verification status
Not yet verified

Documents are linked to a specific chemical form, batch or lot number, document date, named testing laboratory and applicable vial stock. A generic Certificate of Analysis is never applied to future batches.

Section 07

Storage and handling

Storage requirement

Pending batch-specific documentation

Handling

Handle in accordance with the batch-specific Safety Data Sheet once issued. No reconstitution or administration instructions are provided.

Section 08

Regulatory and use restrictions

For laboratory research and analytical use only. Not intended for human or veterinary use, clinical use, diagnostic use, food use, cosmetic application or administration to humans or animals. No instructions concerning dosage, administration, reconstitution or therapeutic use are provided.
Section 09

References

  • Reference CAS: 77591-33-4
  • Database entry: PubChem CID 16132341 (Thymosin β4)
  • Batch-specific documentation: Pending batch-specific documentation
Section 10

Scientific References

Reference links will become available as the catalogue expands.

PubChem — pending
PubMed — pending
UniProt — pending
Literature — pending
Section 11

Related compounds

Related compounds
Similar molecular families