TB-500
Thymosin Beta-4 fragment (TB-500)

- Sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Length
- 43 aa
Product identity
- Product name
- TB-500
- Expanded name
- Thymosin Beta-4 fragment (TB-500)
- Synonyms
- Thymosin β4 fragment, Tβ4 (1-43)
- Research category
- Tissue & Regenerative Research
- Compound type
- Synthetic peptide
Research intelligence
Tissue Research
Synthetic peptide
43 amino acids
Not yet verified
Not yet verified
Sold out · quantity 0
Reference chemical information
Reference chemical information is provided for compound identification only. The exact form, salt, counter-ion, hydration state and molecular mass of a supplied material must be confirmed against its batch-specific Certificate of Analysis and Safety Data Sheet.
- Reference sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Sequence length
- 43 amino acids
- Reference molecular formula
- C212H350N56O78S
- Reference molecular weight
- 4963.44 g/mol
- Reference CAS number
- 77591-33-4
- Reference database
- PubChem CID 16132341 (Thymosin β4)
The name TB-500 is commonly used in the research-peptide supply market for material related to Thymosin Beta-4 or a defined fragment thereof. The exact supplied sequence, salt form and molecular mass must be confirmed against the manufacturer's batch documentation.
Research context
TB-500 is a synthetic peptide related to the naturally occurring protein Thymosin Beta-4. It is investigated in experimental cell-motility, actin-binding and tissue-research contexts.
Current product specification
Values below reflect the physical material available for release. Fields are populated only from manufacturer documentation, a batch-specific Certificate of Analysis, an independent laboratory report or a Safety Data Sheet. Until such documents are received and verified, fields remain marked “Pending batch-specific documentation”.
- Stock status
- Sold out
- Stock quantity
- 0
- Catalogue SKU
- Pending batch-specific documentation
- Actual supplied chemical form
- Pending batch-specific documentation
- Counter-ion or salt form
- Pending batch-specific documentation
- Nominal vial content
- Pending batch-specific documentation
- Supplier
- Pending batch-specific documentation
- Manufacturer
- Pending batch-specific documentation
- Country of manufacture
- Pending batch-specific documentation
- Batch number
- Pending batch-specific documentation
- Lot number
- Pending batch-specific documentation
- Purity result
- Pending batch-specific documentation
- Identity result
- Pending batch-specific documentation
- HPLC result
- Pending batch-specific documentation
- LC-MS result
- Pending batch-specific documentation
- Water content
- Pending batch-specific documentation
- Residual solvent result
- Pending batch-specific documentation
- Endotoxin result
- Pending batch-specific documentation
- Bioburden result
- Pending batch-specific documentation
- Sterility result
- Pending batch-specific documentation
- Manufacturing date
- Pending batch-specific documentation
- Retest or expiry date
- Pending batch-specific documentation
- Storage requirement
- Pending batch-specific documentation
- COA file
- Not supplied
- SDS file
- Not supplied
- Independent test report
- Not supplied
- Document verification status
- Not yet verified
Batch documentation
Documents are linked to a specific chemical form, batch or lot number, document date, named testing laboratory and applicable vial stock. A generic Certificate of Analysis is never applied to future batches.
Storage and handling
Pending batch-specific documentation
Handle in accordance with the batch-specific Safety Data Sheet once issued. No reconstitution or administration instructions are provided.
Regulatory and use restrictions
References
- Reference CAS: 77591-33-4
- Database entry: PubChem CID 16132341 (Thymosin β4)
- Batch-specific documentation: Pending batch-specific documentation
Scientific References
Reference links will become available as the catalogue expands.